PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta002155
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family HD-ZIP
Protein Properties Length: 355aa    MW: 39331.8 Da    PI: 7.2005
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-57382555PU_refplantGDBView CDS
gnl|UG|Pta#S26631190PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.41e-17196250256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Pta002155 196 RKKLRLSKEQSAYLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 250
                778899***********************************************98 PP

2HD-ZIP_I/II127.84.5e-41196285191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlskeq++ LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr+y++l+een+rL+ke +eLr +l
    Pta002155 196 RKKLRLSKEQSAYLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCYETLTEENRRLQKEIQELR-AL 285
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046187.3E-1137148IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.608.1E-18182253IPR009057Homeodomain-like
SuperFamilySSF466892.31E-18189253IPR009057Homeodomain-like
PROSITE profilePS5007117.313192252IPR001356Homeobox domain
SMARTSM003891.6E-15194256IPR001356Homeobox domain
PfamPF000464.0E-15196250IPR001356Homeobox domain
CDDcd000861.76E-15196253No hitNo description
PROSITE patternPS000270227250IPR017970Homeobox, conserved site
PfamPF021831.3E-11252286IPR003106Leucine zipper, homeobox-associated
SMARTSM003405.1E-25252295IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MELGLGLGGE DIVVRPAKSW IQFQQMTSAT KADHVQNTGL VLRLGLELGS QRQNSANPNP  60
PIQLDLLPAA PVPRGFSWQP NTKTCRAVSE NGNCEGDYGE SRSCCQVGGA ASASSPRGFD  120
VNRVPSSADN DDDDDAVVSS PNSTISSFQM DFAMCHATSS AVKRERDGER DNANDDNELE  180
RACSRASDEE DGSATRKKLR LSKEQSAYLE ESFKEHNTLN PKQKLALAKQ LNLRPRQVEV  240
WFQNRRARTK LKQTEVDCEY LKRCYETLTE ENRRLQKEIQ ELRALKVAHP SFYMHLPATT  300
LTMCPSCERI ATASVPTSDN NPRGNLHGHG HGPSPWPALA ATHLRPTRPP ARLEQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1194200TRKKLRL
2244252RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.135830.0embryo| root| xylem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006849539.11e-108PREDICTED: homeobox-leucine zipper protein HOX11
SwissprotQ67UE25e-87HOX11_ORYSJ; Homeobox-leucine zipper protein HOX11
TrEMBLA9NV750.0A9NV75_PICSI; Putative uncharacterized protein
STRINGPOPTR_0016s05890.16e-94(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-64homeobox from Arabidopsis thaliana